אביזרי סלולר וטאבלט,לבית ולגן,אביזרים למחשב,כבלים ואביזרים ועוד

1.67 Rating by ClearWebStats
This website has a #1,178,219 rank in global traffic. It has a .co.il as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, wapa.co.il is SAFE to browse.
Get Custom Widget

Traffic Report of Wapa

Daily Unique Visitors: 408
Daily Pageviews: 816

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 1,178,219
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
52
Siteadvisor Rating
View wapa.co.il site advisor rating Not Applicable

Where is wapa.co.il server located?

Hosted IP Address:

81.218.224.68 View other site hosted with wapa.co.il

Hosted Country:

wapa.co.il hosted country IL wapa.co.il hosted country

Location Latitude:

32.0917

Location Longitude:

34.885

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View wapa.co.il HTML resources

Homepage Links Analysis

wapa - אביזרי סלולר וטאבלט,לבית ולגן,אביזרים למחשב,כבלים ואביזרים ועוד

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 11 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 60
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 81.218.224.68)

מחסני דיו | דיו למדפסת | טונר למדפסת | דיו למדפסת HP

wapa.co.il favicon - mdyo.co.il

מחסני דיו - דיו למדפסת. ראש דיו למדפסת מכל סוג. דיו למדפסת וטונר למדפסת HP, Samsung, Canon, Brother, Xerox Epson, Lexmark, Oki ועוד. דיו וטונר למדפסת במחיר הזול בישראל, משלוחים חינם לכל הארץ.

View wapa.co.il Pagerank   wapa.co.il alexa rank 977,398   wapa.co.il website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: Content-Type
Date: Tue, 10 Jan 2017 13:29:43 GMT
Content-Length: 74905

Domain Information for wapa.co.il

Domain Registrar: ISOC-IL wapa.co.il registrar info
Last Modified: 2000-00-00 2 decades 4 years 4 months ago

Domain Nameserver Information

Host IP Address Country
ns1.mdyo.co.il wapa.co.il name server information 81.218.224.68 wapa.co.il server is located in Israel Israel
ns2.mdyo.co.il wapa.co.il name server information 81.218.224.68 wapa.co.il server is located in Israel Israel

DNS Record Analysis

Host Type TTL Extra
wapa.co.il A 86400 IP:81.218.224.68
wapa.co.il NS 86399 Target:ns.wapa.co.il
wapa.co.il SOA 86400 MNAME:ns.wapa.co.il
RNAME:support.sweethome.co.il
Serial:1454610480
Refresh:10800
Retry:3600
Expire:604800
wapa.co.il MX 86400 Priority:10
Target:mail.wapa.co.il

Similarly Ranked Websites to Wapa


Home

wapa.co.il favicon - jpccollection.be

View wapa.co.il Pagerank   Alexa rank for wapa.co.il 1,178,221   website value of wapa.co.il $ 720.00

Terri Johnson Creates

wapa.co.il favicon - terrijohnsoncreates.com

Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations

View wapa.co.il Pagerank   Alexa rank for wapa.co.il 1,178,221   website value of wapa.co.il $ 720.00

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

wapa.co.il favicon - srisubrahmanyaswamydevalayamskandagiri.org

View wapa.co.il Pagerank   Alexa rank for wapa.co.il 1,178,223   website value of wapa.co.il $ 720.00

Error 406 - Not Acceptable

wapa.co.il favicon - redmondsgrill.com

View wapa.co.il Pagerank   Alexa rank for wapa.co.il 1,178,225   website value of wapa.co.il $ 720.00

Full WHOIS Lookup for wapa.co.il

% The data in the WHOIS database of the .il registry is provided
% by ISOC-IL for information purposes, and to assist persons in
% obtaining information about or related to a domain name
% registration record. ISOC-IL does not guarantee its accuracy.
% By submitting a WHOIS query, you agree that you will use this
% Data only for lawful purposes and that, under no circumstances
% will you use this Data to: (1) allow, enable, or otherwise
% support the transmission of mass unsolicited, commercial
% advertising or solicitations via e-mail (spam);
% or (2) enable high volume, automated, electronic processes that
% apply to ISOC-IL (or its systems).
% ISOC-IL reserves the right to modify these terms at any time.
% By submitting this query, you agree to abide by this policy.

query: wapa.co.il

reg-name: wapa
domain: wapa.co.il

descr: Liron vaknin
descr: Eben gvirol 192
descr: tel aviv
descr: 62032
descr: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
admin-c: GI-LV1487-IL
tech-c: GI-LV1487-IL
zone-c: GI-LV1487-IL
nserver: ns1.mdyo.co.il
nserver: ns2.mdyo.co.il
validity: 08-05-2017
status: Transfer Locked
changed: domain-registrar AT isoc.org.il 20150508 (Assigned)
changed: domain-registrar AT isoc.org.il 20150509 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)

person: Liron vaknin
address: Eben gvirol 192
address: tel aviv
address: 62032
address: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
nic-hdl: GI-LV1487-IL
changed: domain-registrar AT isoc.org.il 20150508

registrar name: Gorni Interactive Ltd
registrar info: http://www.box.co.il/

% Rights to the data above are restricted by copyright.