Web stats for Wapa - wapa.co.il
אביזרי סלולר וטאבלט,לבית ולגן,אביזרים למחשב,כבלים ואביזרים ועוד
1.67 Rating by ClearWebStats
This website has a #1,178,219 rank in global traffic. It has a .co.il as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, wapa.co.il is SAFE to browse.
Traffic Report of Wapa
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,178,219 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
52
Siteadvisor Rating
Not Applicable
Where is wapa.co.il server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | 11 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 60 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 81.218.224.68)
מחסני דיו | דיו למדפסת | טונר למדפסת | דיו למדפסת HP
- mdyo.co.il
מחסני דיו - דיו למדפסת. ראש דיו למדפסת מכל סוג. דיו למדפסת וטונר למדפסת HP, Samsung, Canon, Brother, Xerox Epson, Lexmark, Oki ועוד. דיו וטונר למדפסת במחיר הזול בישראל, משלוחים חינם לכל הארץ.
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: Content-Type
Date: Tue, 10 Jan 2017 13:29:43 GMT
Content-Length: 74905
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: Content-Type
Date: Tue, 10 Jan 2017 13:29:43 GMT
Content-Length: 74905
Domain Information for wapa.co.il
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
wapa.co.il | A | 86400 |
IP:81.218.224.68 |
wapa.co.il | NS | 86399 |
Target:ns.wapa.co.il |
wapa.co.il | SOA | 86400 |
MNAME:ns.wapa.co.il RNAME:support.sweethome.co.il Serial:1454610480 Refresh:10800 Retry:3600 Expire:604800 |
wapa.co.il | MX | 86400 |
Priority:10 Target:mail.wapa.co.il |
Similarly Ranked Websites to Wapa
Cheap Flights | Discount Airfare | Airline Tickets | Cheapseats.com
- cheapseats.com
Terri Johnson Creates
- terrijohnsoncreates.com
Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
Full WHOIS Lookup for wapa.co.il
% The data in the WHOIS database of the .il registry is provided
% by ISOC-IL for information purposes, and to assist persons in
% obtaining information about or related to a domain name
% registration record. ISOC-IL does not guarantee its accuracy.
% By submitting a WHOIS query, you agree that you will use this
% Data only for lawful purposes and that, under no circumstances
% will you use this Data to: (1) allow, enable, or otherwise
% support the transmission of mass unsolicited, commercial
% advertising or solicitations via e-mail (spam);
% or (2) enable high volume, automated, electronic processes that
% apply to ISOC-IL (or its systems).
% ISOC-IL reserves the right to modify these terms at any time.
% By submitting this query, you agree to abide by this policy.
query: wapa.co.il
reg-name: wapa
domain: wapa.co.il
descr: Liron vaknin
descr: Eben gvirol 192
descr: tel aviv
descr: 62032
descr: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
admin-c: GI-LV1487-IL
tech-c: GI-LV1487-IL
zone-c: GI-LV1487-IL
nserver: ns1.mdyo.co.il
nserver: ns2.mdyo.co.il
validity: 08-05-2017
status: Transfer Locked
changed: domain-registrar AT isoc.org.il 20150508 (Assigned)
changed: domain-registrar AT isoc.org.il 20150509 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)
person: Liron vaknin
address: Eben gvirol 192
address: tel aviv
address: 62032
address: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
nic-hdl: GI-LV1487-IL
changed: domain-registrar AT isoc.org.il 20150508
registrar name: Gorni Interactive Ltd
registrar info: http://www.box.co.il/
% Rights to the data above are restricted by copyright.
% by ISOC-IL for information purposes, and to assist persons in
% obtaining information about or related to a domain name
% registration record. ISOC-IL does not guarantee its accuracy.
% By submitting a WHOIS query, you agree that you will use this
% Data only for lawful purposes and that, under no circumstances
% will you use this Data to: (1) allow, enable, or otherwise
% support the transmission of mass unsolicited, commercial
% advertising or solicitations via e-mail (spam);
% or (2) enable high volume, automated, electronic processes that
% apply to ISOC-IL (or its systems).
% ISOC-IL reserves the right to modify these terms at any time.
% By submitting this query, you agree to abide by this policy.
query: wapa.co.il
reg-name: wapa
domain: wapa.co.il
descr: Liron vaknin
descr: Eben gvirol 192
descr: tel aviv
descr: 62032
descr: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
admin-c: GI-LV1487-IL
tech-c: GI-LV1487-IL
zone-c: GI-LV1487-IL
nserver: ns1.mdyo.co.il
nserver: ns2.mdyo.co.il
validity: 08-05-2017
status: Transfer Locked
changed: domain-registrar AT isoc.org.il 20150508 (Assigned)
changed: domain-registrar AT isoc.org.il 20150509 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)
changed: domain-registrar AT isoc.org.il 20150510 (Changed)
person: Liron vaknin
address: Eben gvirol 192
address: tel aviv
address: 62032
address: Israel
phone: +972 54 3217048
e-mail: lironvaknin AT gmail.com
nic-hdl: GI-LV1487-IL
changed: domain-registrar AT isoc.org.il 20150508
registrar name: Gorni Interactive Ltd
registrar info: http://www.box.co.il/
% Rights to the data above are restricted by copyright.